˲ ˲:
  • -
  • ³
  • ij
  • ,
  • '
  • '
  • ˳
  • , '
  • ̳
  • ̳
  • ̳
  • ,
  •  
     

     

     

     

     

     

         
     
         

     

    .

    ? 30-40- , , , .

    - 䳺 , . . , , -. , ' . , , - . , . , , . 1% , .

    '? -. , 20 ,  . ( , , 3 , , 20), -, RHD.

    ˲Ͳ -

    ( ):

    NCBI

    Human RhD blood group antigen mRNA, complete cds

    ORGANISM Homo sapiens

    standard_name = "RhD"

    MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQV

    GQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQ

    FP SGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTA

    LGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKD

    QTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSV

    VTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGL

    VAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVL

    DTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEA

    KYFDDQVFWKFPHLAVGF

    -

    NCBI

    1

    atgagctcta

    agtacccgcg

    gtctgtccgg

    cgctgcctgc

    ccctctgggc

    cctaacactg

    61

    gaagcagctc

    tcattctcct

    cttctatttt

    tttacccact

    atgacgcttc

    cttagaggat

    121

    caaaaggggc

    tcgtggcatc

    ctatcaagtt

    ggccaagatc

    tgaccgtgat

    ggcggccatt

    181

    ggcttgggct

    tcctcacctc

    gagtttccgg

    agacacagct

    ggagcagtgt

    ggccttcaac

    241

    ctcttcatgc

    tggcgcttgg

    tgtgcagtgg

    gcaatcctgc

    tggacggctt

    cctgagccag

    301

    ttcccttctg

    ggaaggtggt

    catcacactg

    ttcagtattc

    ggctggccac

    catgagtgct

    361

    ttgtcggtgc

    tgatctcagt

    ggatgctgtc

    ttggggaagg

    tcaacttggc

    gcagttggtg

    421

    gtgatggtgc

    tggtggaggt

    gacagcttta

    ggcaacctga

    ggatggtcat

    cagtaatatc

    481

    ttcaacacag

    actaccacat

    gaacatgatg

    cacatctacg

    tgttcgcagc

    ctattttggg

    541

    ctgtctgtgg

    cctggtgcct

    gccaaagcct

    ctacccgagg

    gaacggagga

    taaagatcag

    601

    acagcaacga

    tacccagttt

    gtctgccatg

    ctgggcgccc

    tcttcttgtg

    gatgttctgg

    661

    ccaagtttca

    actctgctct

    gctgagaagt

    ccaatcgaaa

    ggaagaatgc

    cgtgttcaac

    721

    acctactatg

    ctgtagcagt

    cagcgtggtg

    acagccatct

    cagggtcatc

    cttggctcac

    781

    ccccaaggga

    agatcagcaa

    gacttatgtg

    cacagtgcgg

    tgttggcagg

    aggcgtggct

    841

    gtgggtacct

    cgtgtcacct

    gatcccttct

    ccgtggcttg

    ccatggtgct

    gggtcttgtg

    901

    gctgggctga

    tctccgtcgg

    gggagccaag

    tacctgccgg

    ggtgttgtaa

    ccgagtgctg

    961

    gggattcccc

    acagctccat

    catgggctac

    aacttcagct

    tgctgggtct

    gcttggagag

    1021

    atcatctaca

    ttgtgttgct

    ggtgcttgat

    accgtcggag

    ccggcaatgg

    catgattggc

    1081

    ttccaggtcc

    tcctcagcat

    tggggaactc

    agcttggcca

    tcgtgatagc

    tctcacgtct

    1141

    ggtctcctga

    caggtttgct

    cctaaatctt

    aaaatatgga

    aagcacctca

    tgaggctaaa

    1201

    tattttgatg

    accaagtttt

    ctggaagttt

    cctcatttgg

    ctgttggatt

    ttaagcaaaa

    1261

    gcatccaaga

    aaaacaaggc

    ctgttcaaaa

    acaagacaac

    ttcctctcac

    tgttgcctgc

    1321

    atttgtacgt

    gagaaacgct

    catgacagca

    aagt//

    (85%) -, 15% , "". , -. , - .

    "" - "" -. - 񳺿 .

    3 -. , 2 , (. 4 ). , , - (. ). , . ҳ - (. 4 ).

    , , , . -, , -. . ' -. 25% (1/2 * 1/2 = 1/4); - - 1/16.

    -. . -, -, Rh +, - . , , ' -. - . ( ). 1609 . , . , , . , -, . , -, -, - , . , -, -, .

    . , Ի ', . , , . , . : , ,  . , , , . ³ , ' . , 쳺, , , , ' .

    http://bio.fizteh.ru

         
     
         
     
     
     

     

     

     

     

     

     

     
     
     
      . Reff.net.ua - !